Lineage for d3qj7a_ (3qj7 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2579104Protein automated matches [190469] (17 species)
    not a true protein
  7. 2579258Species Mycobacterium tuberculosis [TaxId:1773] [189990] (2 PDB entries)
  8. 2579263Domain d3qj7a_: 3qj7 A: [184413]
    Other proteins in same PDB: d3qj7d2
    automated match to d1aiqa_
    complexed with spm, ump

Details for d3qj7a_

PDB Entry: 3qj7 (more details), 2.5 Å

PDB Description: crystal structure of the mycobacterium tuberculosis thymidylate synthase (thya) bound to dump
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d3qj7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qj7a_ d.117.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mtpyedllrfvletgtpksdrtgtgtrslfgqqmrydlsagfpllttkkvhfksvayell
wflrgdsnigwlhehgvtiwdewasdtgelgpiygvqwrswpapsgehidqisaaldllr
tdpdsrriivsawnvgeiermalppchaffqfyvadgrlscqlyqrsadlflgvpfnias
yallthmmaaqaglsvgefiwtggdchiydnhveqvrlqlsreprpypkllladrdsife
ytyedivvknydphpaikap

SCOPe Domain Coordinates for d3qj7a_:

Click to download the PDB-style file with coordinates for d3qj7a_.
(The format of our PDB-style files is described here.)

Timeline for d3qj7a_: