Lineage for d3qfbd_ (3qfb D:)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.1: Thioltransferase [52834] (16 proteins) Protein automated matches [190442] (12 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [189547] (6 PDB entries) 
Domain d3qfbd_: 3qfb D: [196293]
automated match to d3e3ea_
complexed with fad, gol
Details for d3qfbd_
PDB Entry: 3qfb (more details), 2.6 Å
PDB Description: Crystal structure of the human thioredoxin reductase-thioredoxin complex
PDB Compounds: (D:) thioredoxinSCOPe Domain Sequences for d3qfbd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qfbd_ c.47.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svkqiesktafqealdaagdklvvvdfsatwcgpskmikpffhslsekysnviflevdvd
dcqdvasecevksmptfqffkkgqkvgefsgankekleatinelv
SCOPe Domain Coordinates for d3qfbd_:
Click to download the PDB-style file with coordinates for d3qfbd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3qfbd_:
- d3qfbd_ first appeared in SCOPe 2.02
- d3qfbd_ appears in SCOPe 2.03
- d3qfbd_ appears in SCOPe 2.05
- d3qfbd_ appears in the current release, SCOPe 2.08, called d3qfbd1
View in 3D
