Lineage for d3qb4d_ (3qb4 D:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1702133Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1702134Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1702357Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 1702358Protein BMP receptor Ia ectodomain [57359] (1 species)
  7. 1702359Species Human (Homo sapiens) [TaxId:9606] [57360] (11 PDB entries)
  8. 1702367Domain d3qb4d_: 3qb4 D: [200297]
    Other proteins in same PDB: d3qb4a_, d3qb4c_
    automated match to d1rewd_

Details for d3qb4d_

PDB Entry: 3qb4 (more details), 2.28 Å

PDB Description: crystal structure of a tgf-beta ligand-receptor complex
PDB Compounds: (D:) Bone morphogenetic protein receptor type-1A

SCOPe Domain Sequences for d3qb4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qb4d_ g.7.1.3 (D:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
dtlpflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckds
pkaqlrrtieccrtnlcnqylqptlppvv

SCOPe Domain Coordinates for d3qb4d_:

Click to download the PDB-style file with coordinates for d3qb4d_.
(The format of our PDB-style files is described here.)

Timeline for d3qb4d_: