Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (19 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein automated matches [190101] (7 species) not a true protein |
Species Escherichia coli [TaxId:562] [189927] (3 PDB entries) |
Domain d3q9nd_: 3q9n D: [184293] Other proteins in same PDB: d3q9na_, d3q9nb_ automated match to d1awcb_ complexed with cms, coa |
PDB Entry: 3q9n (more details), 2 Å
SCOPe Domain Sequences for d3q9nd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q9nd_ d.211.1.1 (D:) automated matches {Escherichia coli [TaxId: 562]} afgqdlgkklleaaaagqddevrilmangadvnatddngltplhlaaangqleivevllk ngadvnasdsagitplhlaaydghleivevllkhgadvnaydragwtplhlaalsgqlei vevllkhgadvnaqdalgltafdisinqgqedlaeilq
Timeline for d3q9nd_: