Lineage for d3q9nd_ (3q9n D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2238947Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 2238948Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 2238949Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 2239041Protein automated matches [190101] (7 species)
    not a true protein
  7. 2239056Species Escherichia coli [TaxId:562] [189927] (3 PDB entries)
  8. 2239060Domain d3q9nd_: 3q9n D: [184293]
    Other proteins in same PDB: d3q9na_, d3q9nb_
    automated match to d1awcb_
    complexed with cms, coa

Details for d3q9nd_

PDB Entry: 3q9n (more details), 2 Å

PDB Description: In silico and in vitro co-evolution of a high affinity complementary protein-protein interface
PDB Compounds: (D:) consensus ankyrin repeat

SCOPe Domain Sequences for d3q9nd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q9nd_ d.211.1.1 (D:) automated matches {Escherichia coli [TaxId: 562]}
afgqdlgkklleaaaagqddevrilmangadvnatddngltplhlaaangqleivevllk
ngadvnasdsagitplhlaaydghleivevllkhgadvnaydragwtplhlaalsgqlei
vevllkhgadvnaqdalgltafdisinqgqedlaeilq

SCOPe Domain Coordinates for d3q9nd_:

Click to download the PDB-style file with coordinates for d3q9nd_.
(The format of our PDB-style files is described here.)

Timeline for d3q9nd_: