Lineage for d3q7va_ (3q7v A:)
- Root: SCOPe 2.05
Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
contains a cluster of helices and an alpha+beta sandwichSuperfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) Protein automated matches [190161] (23 species)
not a true protein
Species Staphylococcus aureus [TaxId:1280] [189852] (8 PDB entries) 
Domain d3q7va_: 3q7v A: [184266]
automated match to d1xa1c_
complexed with gol, so4
Details for d3q7va_
PDB Entry: 3q7v (more details), 2.1 Å
PDB Description: Beta-Lactam-Sensor Domain of BlaR1 (Apo) from Staphylococcus Aureus with Carboxylated Lys392
PDB Compounds: (A:) Beta-lactamase regulatory protein BlaR1SCOPe Domain Sequences for d3q7va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q7va_ e.3.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
qsitdynykkplhndyqildkskifgsnsgsfvmysmaadayyiynekesrkryspnsty
kiylamfgldrhiindensrmswnhkhypfdawnkeqdlntamqnsvnwyferisdqipk
nytatqlkqlnygnknlgsyksywmedslkisnleqvivfknmmeqnnhfskkaknqlss
sllikknekyelygktgtgivngkynngwfvgyvitnhdkyyfathlsdgkpsgknaeli
sekilkemgvln
SCOPe Domain Coordinates for d3q7va_:
Click to download the PDB-style file with coordinates for d3q7va_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3q7va_:
- d3q7va_ first appeared in SCOPe 2.01
- d3q7va_ appears in SCOPe 2.04
- d3q7va_ appears in SCOPe 2.06
- d3q7va_ appears in the current release, SCOPe 2.08
View in 3D
