Lineage for d3q7va_ (3q7v A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013567Protein automated matches [190161] (29 species)
    not a true protein
  7. 3013942Species Staphylococcus aureus [TaxId:1280] [189852] (11 PDB entries)
  8. 3013949Domain d3q7va_: 3q7v A: [184266]
    automated match to d1xa1c_
    complexed with gol, so4

Details for d3q7va_

PDB Entry: 3q7v (more details), 2.1 Å

PDB Description: Beta-Lactam-Sensor Domain of BlaR1 (Apo) from Staphylococcus Aureus with Carboxylated Lys392
PDB Compounds: (A:) Beta-lactamase regulatory protein BlaR1

SCOPe Domain Sequences for d3q7va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q7va_ e.3.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
qsitdynykkplhndyqildkskifgsnsgsfvmysmaadayyiynekesrkryspnsty
kiylamfgldrhiindensrmswnhkhypfdawnkeqdlntamqnsvnwyferisdqipk
nytatqlkqlnygnknlgsyksywmedslkisnleqvivfknmmeqnnhfskkaknqlss
sllikknekyelygktgtgivngkynngwfvgyvitnhdkyyfathlsdgkpsgknaeli
sekilkemgvln

SCOPe Domain Coordinates for d3q7va_:

Click to download the PDB-style file with coordinates for d3q7va_.
(The format of our PDB-style files is described here.)

Timeline for d3q7va_: