Lineage for d3px8x_ (3px8 X:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2605913Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2605914Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2605915Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 2606087Protein automated matches [190420] (9 species)
    not a true protein
  7. 2606094Species Castor bean (Ricinus communis) [TaxId:3988] [188830] (15 PDB entries)
  8. 2606095Domain d3px8x_: 3px8 X: [184056]
    automated match to d1apga_
    complexed with jp2

Details for d3px8x_

PDB Entry: 3px8 (more details), 1.29 Å

PDB Description: rta in complex with 7-carboxy-pterin
PDB Compounds: (X:) Preproricin

SCOPe Domain Sequences for d3px8x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3px8x_ d.165.1.1 (X:) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]}
kqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvels
nhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggny
drleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqy
iegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvy
dvsilipiialmvyrcap

SCOPe Domain Coordinates for d3px8x_:

Click to download the PDB-style file with coordinates for d3px8x_.
(The format of our PDB-style files is described here.)

Timeline for d3px8x_: