Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) |
Family d.165.1.1: Plant cytotoxins [56372] (18 proteins) |
Protein automated matches [190420] (9 species) not a true protein |
Species Castor bean (Ricinus communis) [TaxId:3988] [188830] (15 PDB entries) |
Domain d3px8x_: 3px8 X: [184056] automated match to d1apga_ complexed with jp2 |
PDB Entry: 3px8 (more details), 1.29 Å
SCOPe Domain Sequences for d3px8x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3px8x_ d.165.1.1 (X:) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]} kqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvels nhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggny drleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqy iegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvy dvsilipiialmvyrcap
Timeline for d3px8x_: