Lineage for d3pvtc_ (3pvt C:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.25: Ferritin-like [47239] (6 superfamilies)
core: 4 helices; bundle, closed, left-handed twist; 1 crossover connectionSuperfamily a.25.1: Ferritin-like [47240] (10 families) 
contains bimetal-ion centre in the middle of the bundle
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) 
Protein automated matches [190435] (9 species)
not a true protein
Species Escherichia coli [TaxId:511145] [189613] (7 PDB entries) 
Domain d3pvtc_: 3pvt C: [184018]
automated match to d1otka_
complexed with 3hc, gol
Details for d3pvtc_
PDB Entry: 3pvt (more details), 2.03 Å
PDB Description: The Phenylacetyl-CoA monooxygenase PaaAC subcomplex with 3-hydroxybutanoyl-CoA
PDB Compounds: (C:) Phenylacetic acid degradation protein paaCSCOPe Domain Sequences for d3pvtc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pvtc_ a.25.1.2 (C:) automated matches {Escherichia coli [TaxId: 511145]}
snqltaytlrlgdnclvlsqrlgewcghapeleidlalanigldllgqarnflsyaaela
gegdedtlaftrderqfsnlllveqpngnfadtiarqyfidawhvalftrlmesrdpqla
aisakaikearyhlrfsrgwlerlgngtdvsgqkmqqainklwrftaelfdadeidials
eegiavdprtlraaweaevfagineatlnvpqeqayrtggkkglhtehlgpmlaemqylq
rvlpgqqw
SCOPe Domain Coordinates for d3pvtc_:
Click to download the PDB-style file with coordinates for d3pvtc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3pvtc_:
- d3pvtc_ first appeared in SCOPe 2.01
- d3pvtc_ appears in SCOPe 2.04
- d3pvtc_ is called d3pvtc1 in SCOPe 2.06
- d3pvtc_ appears in the current release, SCOPe 2.08, called d3pvtc1
View in 3D
