![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.3: Penicillin V acylase [56248] (2 proteins) automatically mapped to Pfam PF02275 |
![]() | Protein Penicillin V acylase [56249] (1 species) |
![]() | Species Bacillus sphaericus [TaxId:1421] [56250] (2 PDB entries) |
![]() | Domain d3pvaa_: 3pva A: [41854] |
PDB Entry: 3pva (more details), 2.8 Å
SCOPe Domain Sequences for d3pvaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pvaa_ d.153.1.3 (A:) Penicillin V acylase {Bacillus sphaericus [TaxId: 1421]} csslsirttddkslfartmdftmepdskviivprnygirllekenvvinnsyafvgmgst ditspvlydgvnekglmgamlyyatfatyadepkkgttginpvyvisqvlgncvtvddvi ekltsytllneaniilgfapplhytftdasgesiviepdktgitihrktigvmtnspgye whqtnlrayigvtpnppqdimmgdldltpfgqgagglglpgdftpsarflrvaywkkyte kaknetegvtnlfhilssvnipkgvvltnegktdytiytsamcaqsknyyfklydnsris avslmaenlnsqdlitfewdrkqdikqlnqvnvm
Timeline for d3pvaa_: