Lineage for d3pmpa_ (3pmp A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553283Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1553284Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1553285Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 1553529Protein automated matches [190077] (17 species)
    not a true protein
  7. 1553579Species Moniliophthora perniciosa [TaxId:153609] [189814] (2 PDB entries)
  8. 1553580Domain d3pmpa_: 3pmp A: [183848]
    automated match to d2cfea1

Details for d3pmpa_

PDB Entry: 3pmp (more details), 1.47 Å

PDB Description: Crystal Structure of Cyclophilin A from Moniliophthora perniciosa in complex with Cyclosporin A
PDB Compounds: (A:) cyclophilin a

SCOPe Domain Sequences for d3pmpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pmpa_ b.62.1.1 (A:) automated matches {Moniliophthora perniciosa [TaxId: 153609]}
amanvffnisindkpegrivfklydeavpktaknfrelatgqhgfgykdsifhrvipqfm
lqggdftrhngtggksiygekfadenfqvkhtkpgllsmanagantngsqffittvptsw
ldgkhvvfgeviegldivrkvegkgsasgktnatikitdcgtv

SCOPe Domain Coordinates for d3pmpa_:

Click to download the PDB-style file with coordinates for d3pmpa_.
(The format of our PDB-style files is described here.)

Timeline for d3pmpa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3pmpb_