Class g: Small proteins [56992] (91 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins) |
Protein automated matches [190290] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187095] (6 PDB entries) |
Domain d3p9wc_: 3p9w C: [193750] Other proteins in same PDB: d3p9wb_, d3p9wd_, d3p9wf_, d3p9wh_ automated match to d1katv_ |
PDB Entry: 3p9w (more details), 2.41 Å
SCOPe Domain Sequences for d3p9wc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p9wc_ g.17.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpt eesnitmqimrikphqgqhigemsflqhnkcecrpkk
Timeline for d3p9wc_: