Lineage for d3p9wc_ (3p9w C:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1703391Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1703392Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1703393Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)
  6. 1703459Protein automated matches [190290] (1 species)
    not a true protein
  7. 1703460Species Human (Homo sapiens) [TaxId:9606] [187095] (6 PDB entries)
  8. 1703463Domain d3p9wc_: 3p9w C: [193750]
    Other proteins in same PDB: d3p9wb_, d3p9wd_, d3p9wf_, d3p9wh_
    automated match to d1katv_

Details for d3p9wc_

PDB Entry: 3p9w (more details), 2.41 Å

PDB Description: Crystal structure of an engineered human autonomous VH Domain in complex with VEGF
PDB Compounds: (C:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d3p9wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p9wc_ g.17.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hevvkfmdvyqrsychpietlvdifqeypdeieyifkpscvplmrcggccndeglecvpt
eesnitmqimrikphqgqhigemsflqhnkcecrpkk

SCOPe Domain Coordinates for d3p9wc_:

Click to download the PDB-style file with coordinates for d3p9wc_.
(The format of our PDB-style files is described here.)

Timeline for d3p9wc_: