Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.88: SRF-like [55454] (1 superfamily) alpha-beta(2)-alpha; dimer; 3 layers a/b/a; antiparallel beta-sheet |
Superfamily d.88.1: SRF-like [55455] (1 family) |
Family d.88.1.1: SRF-like [55456] (5 proteins) |
Protein automated matches [191130] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189221] (3 PDB entries) |
Domain d3p57j_: 3p57 J: [196251] automated match to d3kova_ protein/DNA complex; complexed with zn |
PDB Entry: 3p57 (more details), 2.19 Å
SCOPe Domain Sequences for d3p57j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p57j_ d.88.1.1 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]} grkkiqitrimdernrqvtftkrkfglmkkayelsvlcdceialiifnssnklfqyastd mdkvllkyteynephesrtnsdivealnkk
Timeline for d3p57j_: