Lineage for d3o6oa_ (3o6o A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
8-stranded mixed beta-sheet; 2 layers: alpha/betaSuperfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) 
Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins) Protein automated matches [190229] (10 species)
not a true protein
Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [189431] (2 PDB entries) 
Domain d3o6oa_: 3o6o A: [182839]
automated match to d1uy6a_
complexed with 1pe, 94m
Details for d3o6oa_
PDB Entry: 3o6o (more details), 2 Å
PDB Description: crystal structure of the n-terminal domain of an hsp90 from trypanosoma brucei, tb10.26.1080 in the presence of an the inhibitor biib021
PDB Compounds: (A:) Heat shock protein 83SCOPe Domain Sequences for d3o6oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o6oa_ d.122.1.1 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
gmtetfafqaeinqlmsliintfysnkeiflrelisnssdacdkiryqsltnqsvlgdep
hlrirvipdrvnktltvedsgigmtkadlvnnlgtiarsgtksfmealeaggdmsmigqf
gvgfysaylvadrvtvvsknneddaytwessaggtftvtstpdcdlkrgtrivlhlkedq
qeyleerrlkdlikkhsefigydielmve
SCOPe Domain Coordinates for d3o6oa_:
Click to download the PDB-style file with coordinates for d3o6oa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3o6oa_:
- d3o6oa_ first appeared in SCOPe 2.01
- d3o6oa_ appears in SCOPe 2.04
- d3o6oa_ is called d3o6oa1 in SCOPe 2.06
- d3o6oa_ appears in the current release, SCOPe 2.08, called d3o6oa1
View in 3D
