Lineage for d3o6oa_ (3o6o A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1039421Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1039422Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 1039423Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 1039563Protein automated matches [190229] (4 species)
    not a true protein
  7. 1039619Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [189431] (1 PDB entry)
  8. 1039620Domain d3o6oa_: 3o6o A: [182839]
    automated match to d1uy6a_
    complexed with 1pe, 94m

Details for d3o6oa_

PDB Entry: 3o6o (more details), 2 Å

PDB Description: crystal structure of the n-terminal domain of an hsp90 from trypanosoma brucei, tb10.26.1080 in the presence of an the inhibitor biib021
PDB Compounds: (A:) Heat shock protein 83

SCOPe Domain Sequences for d3o6oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o6oa_ d.122.1.1 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
gmtetfafqaeinqlmsliintfysnkeiflrelisnssdacdkiryqsltnqsvlgdep
hlrirvipdrvnktltvedsgigmtkadlvnnlgtiarsgtksfmealeaggdmsmigqf
gvgfysaylvadrvtvvsknneddaytwessaggtftvtstpdcdlkrgtrivlhlkedq
qeyleerrlkdlikkhsefigydielmve

SCOPe Domain Coordinates for d3o6oa_:

Click to download the PDB-style file with coordinates for d3o6oa_.
(The format of our PDB-style files is described here.)

Timeline for d3o6oa_: