Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.24: Pyridoxine 5'-phosphate synthase [63892] (2 families) |
Family c.1.24.0: automated matches [191640] (1 protein) not a true family |
Protein automated matches [191177] (2 species) not a true protein |
Species Campylobacter jejuni [TaxId:192222] [189430] (2 PDB entries) |
Domain d3o6ca_: 3o6c A: [182834] automated match to d1ho1a_ complexed with po4 |
PDB Entry: 3o6c (more details), 1.87 Å
SCOPe Domain Sequences for d3o6ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o6ca_ c.1.24.0 (A:) automated matches {Campylobacter jejuni [TaxId: 192222]} namllgvnidhiavlrqarmvndpdlleaafivarhgdqitlhvredrrhaqdfdlenii kfckspvnlecalndeilnlalklkphrvtlvpekreelttegglclnhaklkqsieklq nanievslfinpslediekskilkaqfielhtghyanlhnalfsnishtafalkeldqdk ktlqaqfekelqnlelcakkglelglkvaaghglnyknvkpvvkikeicelnigqsivar svftglqnailemkelikr
Timeline for d3o6ca_: