| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.24: Pyridoxine 5'-phosphate synthase [63892] (2 families) ![]() |
| Family c.1.24.0: automated matches [191640] (1 protein) not a true family |
| Protein automated matches [191177] (4 species) not a true protein |
| Species Campylobacter jejuni [TaxId:192222] [189430] (2 PDB entries) |
| Domain d3o6ca1: 3o6c A:1-257 [182834] Other proteins in same PDB: d3o6ca2 automated match to d1ho1a_ complexed with po4 |
PDB Entry: 3o6c (more details), 1.87 Å
SCOPe Domain Sequences for d3o6ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o6ca1 c.1.24.0 (A:1-257) automated matches {Campylobacter jejuni [TaxId: 192222]}
mllgvnidhiavlrqarmvndpdlleaafivarhgdqitlhvredrrhaqdfdleniikf
ckspvnlecalndeilnlalklkphrvtlvpekreelttegglclnhaklkqsieklqna
nievslfinpslediekskilkaqfielhtghyanlhnalfsnishtafalkeldqdkkt
lqaqfekelqnlelcakkglelglkvaaghglnyknvkpvvkikeicelnigqsivarsv
ftglqnailemkelikr
Timeline for d3o6ca1: