SCOPe 2.08: Domain d3o6ca1: 3o6c A:1-257

Lineage for d3o6ca1 (3o6c A:1-257)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.24: Pyridoxine 5'-phosphate synthase [63892] (2 families)

5. Family c.1.24.0: automated matches [191640] (1 protein)
   not a true family

6. Protein automated matches [191177] (4 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [189430] (2 PDB entries)

8. Domain d3o6ca1: 3o6c A:1-257 [182834]
   Other proteins in same PDB: d3o6ca2
   automated match to d1ho1a_
   complexed with po4

Details for d3o6ca1

PDB Entry: 3o6c, 1.87 Å

PDB Description: pyridoxal phosphate biosynthetic protein pdxj from campylobacter jejuni

PDB Compounds: (A:) pyridoxine 5'-phosphate synthase

SCOPe Domain Sequences for d3o6ca1:

Sequence; same for both SEQRES and ATOM records:

>d3o6ca1 c.1.24.0 (A:1-257) automated matches {Campylobacter jejuni [TaxId: 192222]}
mllgvnidhiavlrqarmvndpdlleaafivarhgdqitlhvredrrhaqdfdleniikf
ckspvnlecalndeilnlalklkphrvtlvpekreelttegglclnhaklkqsieklqna
nievslfinpslediekskilkaqfielhtghyanlhnalfsnishtafalkeldqdkkt
lqaqfekelqnlelcakkglelglkvaaghglnyknvkpvvkikeicelnigqsivarsv
ftglqnailemkelikr

Timeline for d3o6ca1:

• d3o6ca1 first appeared in SCOPe 2.01, called d3o6ca_
  
• d3o6ca1 appears in SCOPe 2.07