Lineage for d3n7ha_ (3n7h A:)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.39: EF Hand-like [47472] (4 superfamilies)
core: 4 helices; array of 2 hairpins, opened
Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) 
the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavityFamily a.39.2.0: automated matches [191595] (1 protein)
not a true familyProtein automated matches [191085] (10 species)
not a true protein
Species Anopheles gambiae [TaxId:180454] [193180] (4 PDB entries) 
Domain d3n7ha_: 3n7h A: [213780]
automated match to d4fqtb_
complexed with cl, de3, mg, moh, peu
Details for d3n7ha_
PDB Entry: 3n7h (more details), 1.6 Å
PDB Description: crystal structure of odorant binding protein 1 from anopheles gambiae (agamobp1) with deet (n,n-diethyl-meta-toluamide) and peg
PDB Compounds: (A:) odorant binding proteinSCOPe Domain Sequences for d3n7ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n7ha_ a.39.2.0 (A:) automated matches {Anopheles gambiae [TaxId: 180454]}
dttprrdaeypppellealkplhdiclgktgvteeaikkfsdeeihedeklkcymnclfh
eakvvddngdvhleklhdslpssmhdiamhmgkrclypegetlcdkafwlhkcwkqsdpk
hyflv
SCOPe Domain Coordinates for d3n7ha_:
Click to download the PDB-style file with coordinates for d3n7ha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3n7ha_:
- d3n7ha_ first appeared in SCOPe 2.03
- d3n7ha_ appears in SCOPe 2.06
- d3n7ha_ appears in the current release, SCOPe 2.08
View in 3D
