Lineage for d3mzgb2 (3mzg B:101-206)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1767525Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1767526Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1767985Protein automated matches [190888] (1 species)
    not a true protein
  7. 1767986Species Human (Homo sapiens) [TaxId:9606] [188282] (27 PDB entries)
  8. 1768009Domain d3mzgb2: 3mzg B:101-206 [232959]
    Other proteins in same PDB: d3mzga_
    automated match to d3d48r2
    complexed with cl, na

Details for d3mzgb2

PDB Entry: 3mzg (more details), 2.1 Å

PDB Description: Crystal structure of a human prolactin receptor antagonist in complex with the extracellular domain of the human prolactin receptor
PDB Compounds: (B:) Prolactin receptor

SCOPe Domain Sequences for d3mzgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mzgb2 b.1.2.1 (B:101-206) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqpdpplelavevkqpedrkpylwikwspptlidlktgwftllyeirlkpekaaeweihf
agqqtefkilslhpgqkylvqvrckpdhgywsawspatfiqipsdf

SCOPe Domain Coordinates for d3mzgb2:

Click to download the PDB-style file with coordinates for d3mzgb2.
(The format of our PDB-style files is described here.)

Timeline for d3mzgb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mzgb1
View in 3D
Domains from other chains:
(mouse over for more information)
d3mzga_