Details for d3mt6w_

PDB Entry: 3mt6 (more details), 1.9 Å

PDB Compounds: (W:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d3mt6w_:

Sequence, based on SEQRES records: (download)

>d3mt6w_ c.14.1.1 (W:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiyl
yinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmi
hqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeave
yglvdsilthr

Sequence, based on observed residues (ATOM records): (download)

>d3mt6w_ c.14.1.1 (W:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lvpmvisfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyinspggv
itagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqplggyq
gqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyglvdsil
thr

SCOPe Domain Coordinates for d3mt6w_:

Timeline for d3mt6w_:

• d3mt6w_ first appeared in SCOPe 2.03
  
• d3mt6w_ appears in SCOPe 2.07
  

Thumbnails for d3mt6w_:

d3mt6w_ (click for larger image) View in 3D

d3mt6w_ in context of chain View in 3D

d3mt6w_ in context of PDB d3mt6a_ in context of PDB d3mt6b_ in context of PDB d3mt6c_ in context of PDB d3mt6d_ in context of PDB d3mt6e_ in context of PDB d3mt6f_ in context of PDB d3mt6g_ in context of PDB d3mt6h_ in context of PDB d3mt6i_ in context of PDB d3mt6j_ in context of PDB d3mt6k_ in context of PDB d3mt6l_ in context of PDB d3mt6m_ in context of PDB d3mt6n_ in context of PDB d3mt6o_ in context of PDB d3mt6p_ in context of PDB d3mt6q_ in context of PDB d3mt6r_ in context of PDB d3mt6s_ in context of PDB d3mt6t_ in context of PDB d3mt6u_ in context of PDB d3mt6v_ in context of PDB d3mt6x_ in context of PDB d3mt6y_ in context of PDB d3mt6z_ in context of PDB View in 3D Domains from other chains: (mouse over for more information) d3mt6a_, d3mt6b_, d3mt6c_, d3mt6d_, d3mt6e_, d3mt6f_, d3mt6g_, d3mt6h_, d3mt6i_, d3mt6j_, d3mt6k_, d3mt6l_, d3mt6m_, d3mt6n_, d3mt6o_, d3mt6p_, d3mt6q_, d3mt6r_, d3mt6s_, d3mt6t_, d3mt6u_, d3mt6v_, d3mt6x_, d3mt6y_, d3mt6z_