Lineage for d3mt6b_ (3mt6 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2852295Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2852608Protein automated matches [190149] (14 species)
    not a true protein
  7. 2852682Species Escherichia coli K-12 [TaxId:83333] [196414] (1 PDB entry)
  8. 2852684Domain d3mt6b_: 3mt6 B: [199874]
    automated match to d3mt6g_
    complexed with mpd

Details for d3mt6b_

PDB Entry: 3mt6 (more details), 1.9 Å

PDB Description: structure of clpp from escherichia coli in complex with adep1
PDB Compounds: (B:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d3mt6b_:

Sequence, based on SEQRES records: (download)

>d3mt6b_ c.14.1.1 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy
lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm
ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav
eyglvdsilth

Sequence, based on observed residues (ATOM records): (download)

>d3mt6b_ c.14.1.1 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
alvpmvieqtersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyi
nspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihq
plggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyg
lvdsilth

SCOPe Domain Coordinates for d3mt6b_:

Click to download the PDB-style file with coordinates for d3mt6b_.
(The format of our PDB-style files is described here.)

Timeline for d3mt6b_: