![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
![]() | Protein automated matches [190149] (14 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [196414] (1 PDB entry) |
![]() | Domain d3mt6b_: 3mt6 B: [199874] automated match to d3mt6g_ complexed with mpd |
PDB Entry: 3mt6 (more details), 1.9 Å
SCOPe Domain Sequences for d3mt6b_:
Sequence, based on SEQRES records: (download)
>d3mt6b_ c.14.1.1 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]} alvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiy lyinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvm ihqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeav eyglvdsilth
>d3mt6b_ c.14.1.1 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]} alvpmvieqtersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyi nspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihq plggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveyg lvdsilth
Timeline for d3mt6b_: