Lineage for d3mdkb1 (3mdk B:1-83)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1855386Species Pseudomonas putida [TaxId:160488] [255962] (1 PDB entry)
  8. 1855388Domain d3mdkb1: 3mdk B:1-83 [247658]
    Other proteins in same PDB: d3mdka2, d3mdkb2
    automated match to d4hoja1

Details for d3mdkb1

PDB Entry: 3mdk (more details), 1.85 Å

PDB Description: structure of stringent starvation protein a (sspa) from pseudomonas putida
PDB Compounds: (B:) stringent starvation protein A

SCOPe Domain Sequences for d3mdkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mdkb1 c.47.1.0 (B:1-83) automated matches {Pseudomonas putida [TaxId: 160488]}
lgatnrlacysdpadhyshrvrlvlaekgvsvqlidvdpahlprklaevnpygsvptlvd
rdlalyestvvmeyleeryphpp

SCOPe Domain Coordinates for d3mdkb1:

Click to download the PDB-style file with coordinates for d3mdkb1.
(The format of our PDB-style files is described here.)

Timeline for d3mdkb1:

1855388
d3mdkb1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3mdkb2