Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (147 species) not a true protein |
Species Pseudomonas putida [TaxId:160488] [255962] (1 PDB entry) |
Domain d3mdkb1: 3mdk B:1-83 [247658] Other proteins in same PDB: d3mdka2, d3mdkb2 automated match to d4hoja1 |
PDB Entry: 3mdk (more details), 1.85 Å
SCOPe Domain Sequences for d3mdkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mdkb1 c.47.1.0 (B:1-83) automated matches {Pseudomonas putida [TaxId: 160488]} lgatnrlacysdpadhyshrvrlvlaekgvsvqlidvdpahlprklaevnpygsvptlvd rdlalyestvvmeyleeryphpp
Timeline for d3mdkb1: