SCOPe 2.08: Domain d3mdkb1: 3mdk B:2-83

Lineage for d3mdkb1 (3mdk B:2-83)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:160488] [255962] (1 PDB entry)

8. Domain d3mdkb1: 3mdk B:2-83 [247658]
   Other proteins in same PDB: d3mdka2, d3mdkb2, d3mdkb3
   automated match to d4hoja1

Details for d3mdkb1

PDB Entry: 3mdk, 1.85 Å

PDB Description: structure of stringent starvation protein a (sspa) from pseudomonas putida

PDB Compounds: (B:) stringent starvation protein A

SCOPe Domain Sequences for d3mdkb1:

Sequence; same for both SEQRES and ATOM records:

>d3mdkb1 c.47.1.0 (B:2-83) automated matches {Pseudomonas putida [TaxId: 160488]}
gatnrlacysdpadhyshrvrlvlaekgvsvqlidvdpahlprklaevnpygsvptlvdr
dlalyestvvmeyleeryphpp

Timeline for d3mdkb1:

• d3mdkb1 first appeared in SCOPe 2.04
  
• d3mdkb1 appears in SCOPe 2.07