Lineage for d3mcwa_ (3mcw A:)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) 
Family c.33.1.0: automated matches [191389] (1 protein)
not a true familyProtein automated matches [190499] (25 species)
not a true protein
Species Chromobacterium violaceum [TaxId:243365] [193722] (1 PDB entry) 
Domain d3mcwa_: 3mcw A: [199828]
automated match to d3mcwb_
complexed with edo, iod
Details for d3mcwa_
PDB Entry: 3mcw (more details), 1.06 Å
PDB Description: crystal structure of an a putative hydrolase of the isochorismatase family (cv_1320) from chromobacterium violaceum atcc 12472 at 1.06 a resolution
PDB Compounds: (A:) Putative hydrolaseSCOPe Domain Sequences for d3mcwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mcwa_ c.33.1.0 (A:) automated matches {Chromobacterium violaceum [TaxId: 243365]}
aplrfssdkpllllidmqqavddpswgprnhpqaeqacagllqawrarglplihirhdsv
epnstyrpgqpghafkpeveprpgetviakqtnsafigtgleallrangwlelvvagvst
snsveatvrmagnlgfavclaedgcftfdktdwhgrrrsadevhamslanldgeycrvcg
sadilaalgniagaa
SCOPe Domain Coordinates for d3mcwa_:
Click to download the PDB-style file with coordinates for d3mcwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3mcwa_:
- d3mcwa_ first appeared in SCOPe 2.03
- d3mcwa_ appears in SCOPe 2.06
- d3mcwa_ appears in the current release, SCOPe 2.08
View in 3D
