Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) |
Family c.48.1.0: automated matches [227237] (1 protein) not a true family |
Protein automated matches [226991] (9 species) not a true protein |
Species Bacillus anthracis [TaxId:261594] [255873] (3 PDB entries) |
Domain d3m49a3: 3m49 A:528-666 [247601] Other proteins in same PDB: d3m49a1, d3m49a2, d3m49b1, d3m49b2 automated match to d1itza3 complexed with acy, btb, fmt, gol, mg, peg, pg5, so4, tdp, trs |
PDB Entry: 3m49 (more details), 2 Å
SCOPe Domain Sequences for d3m49a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m49a3 c.48.1.0 (A:528-666) automated matches {Bacillus anthracis [TaxId: 261594]} egakddtyekvakgayvvsaskketadvillatgsevslaveaqkalavdgvdasvvsmp smdrfeaqtaeykesvlpkavtkrfaiemgatfgwhryvglegdvlgidtfgasapgeki meeygftvenvvrkvkeml
Timeline for d3m49a3: