Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (147 species) not a true protein |
Species Pseudomonas fluorescens [TaxId:220664] [255947] (2 PDB entries) |
Domain d3m3ma1: 3m3m A:0-80 [247586] Other proteins in same PDB: d3m3ma2 automated match to d4l8ea1 complexed with edo, gsh, na |
PDB Entry: 3m3m (more details), 1.75 Å
SCOPe Domain Sequences for d3m3ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m3ma1 c.47.1.0 (A:0-80) automated matches {Pseudomonas fluorescens [TaxId: 220664]} slykvygdyrsgncykiklmlnllglpyewqavdilggdtqteaflaknpngkipvlele dgtclwesnailnfladgsqf
Timeline for d3m3ma1: