Lineage for d3m3ma1 (3m3m A:0-80)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1855380Species Pseudomonas fluorescens [TaxId:220664] [255947] (2 PDB entries)
  8. 1855383Domain d3m3ma1: 3m3m A:0-80 [247586]
    Other proteins in same PDB: d3m3ma2
    automated match to d4l8ea1
    complexed with edo, gsh, na

Details for d3m3ma1

PDB Entry: 3m3m (more details), 1.75 Å

PDB Description: crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5]
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d3m3ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m3ma1 c.47.1.0 (A:0-80) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
slykvygdyrsgncykiklmlnllglpyewqavdilggdtqteaflaknpngkipvlele
dgtclwesnailnfladgsqf

SCOPe Domain Coordinates for d3m3ma1:

Click to download the PDB-style file with coordinates for d3m3ma1.
(The format of our PDB-style files is described here.)

Timeline for d3m3ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3m3ma2