Lineage for d3m3ma1 (3m3m A:2-80)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880216Species Pseudomonas fluorescens [TaxId:220664] [255947] (2 PDB entries)
  8. 2880219Domain d3m3ma1: 3m3m A:2-80 [247586]
    Other proteins in same PDB: d3m3ma2, d3m3ma3
    automated match to d4l8ea1
    complexed with edo, gsh, na

Details for d3m3ma1

PDB Entry: 3m3m (more details), 1.75 Å

PDB Description: crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5]
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d3m3ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m3ma1 c.47.1.0 (A:2-80) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
ykvygdyrsgncykiklmlnllglpyewqavdilggdtqteaflaknpngkipvleledg
tclwesnailnfladgsqf

SCOPe Domain Coordinates for d3m3ma1:

Click to download the PDB-style file with coordinates for d3m3ma1.
(The format of our PDB-style files is described here.)

Timeline for d3m3ma1: