Lineage for d3m1nb_ (3m1n B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.65: Hedgehog/DD-peptidase [55165] (1 superfamily)
alpha-beta(2)-alpha-beta(2); 2 layers: alpha/betaSuperfamily d.65.1: Hedgehog/DD-peptidase [55166] (5 families) 
zinc-binding motif
Family d.65.1.2: Hedgehog (development protein), N-terminal signaling domain [55170] (3 proteins)
automatically mapped to Pfam PF01085Protein automated matches [190324] (2 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [188953] (17 PDB entries) 
Domain d3m1nb_: 3m1n B: [180717]
automated match to d1vhha_
complexed with so4, zn
Details for d3m1nb_
PDB Entry: 3m1n (more details), 1.85 Å
PDB Description: crystal structure of human sonic hedgehog n-terminal domain
PDB Compounds: (B:) Sonic hedgehog proteinSCOPe Domain Sequences for d3m1nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m1nb_ d.65.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iigpgrgfgkrrhpkkltplaykqfipnvaektlgasgryegkisrnserfkeltpnynp
diifkdeentgadrlmtqrckdklnalaisvmnqwpgvklrvtegwdedghhseeslhye
gravdittsdrdrskygmlarlaveagfdwvyyeskahihcsvkaens
SCOPe Domain Coordinates for d3m1nb_:
Click to download the PDB-style file with coordinates for d3m1nb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3m1nb_:
- d3m1nb_ first appeared in SCOPe 2.01
- d3m1nb_ appears in SCOPe 2.07
View in 3D
