Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) |
Family c.23.8.0: automated matches [191522] (1 protein) not a true family |
Protein automated matches [190879] (8 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [189365] (1 PDB entry) |
Domain d3lp6b_: 3lp6 B: [180489] automated match to d1o4va_ complexed with fmt, gol |
PDB Entry: 3lp6 (more details), 1.7 Å
SCOPe Domain Sequences for d3lp6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lp6b_ c.23.8.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} rprvgvimgsdsdwpvmadaaaalaefdipaevrvvsahrtpeamfsyargaaarglevi iagaggaahlpgmvaaatplpvigvpvplgrldgldsllsivqmpagvpvatvsiggagn agllavrmlgaanpqlrarivafqdrladvvaakdaelqrlagkltr
Timeline for d3lp6b_: