Lineage for d3lp6b_ (3lp6 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2116261Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) (S)
  5. 2116372Family c.23.8.0: automated matches [191522] (1 protein)
    not a true family
  6. 2116373Protein automated matches [190879] (8 species)
    not a true protein
  7. 2116419Species Mycobacterium tuberculosis [TaxId:1773] [189365] (1 PDB entry)
  8. 2116421Domain d3lp6b_: 3lp6 B: [180489]
    automated match to d1o4va_
    complexed with fmt, gol

Details for d3lp6b_

PDB Entry: 3lp6 (more details), 1.7 Å

PDB Description: crystal structure of rv3275c-e60a from mycobacterium tuberculosis at 1.7a resolution
PDB Compounds: (B:) Phosphoribosylaminoimidazole carboxylase catalytic subunit

SCOPe Domain Sequences for d3lp6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lp6b_ c.23.8.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
rprvgvimgsdsdwpvmadaaaalaefdipaevrvvsahrtpeamfsyargaaarglevi
iagaggaahlpgmvaaatplpvigvpvplgrldgldsllsivqmpagvpvatvsiggagn
agllavrmlgaanpqlrarivafqdrladvvaakdaelqrlagkltr

SCOPe Domain Coordinates for d3lp6b_:

Click to download the PDB-style file with coordinates for d3lp6b_.
(The format of our PDB-style files is described here.)

Timeline for d3lp6b_: