| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
| Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
| Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species) |
| Species Silkworm (Bombyx mori) [TaxId:7091] [189285] (2 PDB entries) |
| Domain d3l9yb_: 3l9y B: [180135] automated match to d1hl4a_ complexed with cu, zn |
PDB Entry: 3l9y (more details), 1.8 Å
SCOPe Domain Sequences for d3l9yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l9yb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Silkworm (Bombyx mori) [TaxId: 7091]}
mpakavcvlrgdvsgtvffdqqdekspvvvsgevqgltkgkhgfhvhefgdntngctsag
ahfnpekqdhggpssavrhvgdlgnieaiedagvtkvsiqdsqislhgpnsiigrtlvvh
adpddlglggnelskttgnaggriacgviglaki
Timeline for d3l9yb_: