Lineage for d3l9yb_ (3l9y B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) 
has additional strand at N-terminusFamily b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) 
Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species) 
Species Silkworm (Bombyx mori) [TaxId:7091] [189285] (2 PDB entries) 
Domain d3l9yb_: 3l9y B: [180135]
automated match to d1hl4a_
complexed with cu, zn
Details for d3l9yb_
PDB Entry: 3l9y (more details), 1.8 Å
PDB Description: crystal structures of holo and cu-deficient cu/znsod from the silkworm bombyx mori and the implications in amyotrophic lateral sclerosis
PDB Compounds: (B:) Superoxide dismutase [Cu-Zn]SCOPe Domain Sequences for d3l9yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l9yb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Silkworm (Bombyx mori) [TaxId: 7091]}
mpakavcvlrgdvsgtvffdqqdekspvvvsgevqgltkgkhgfhvhefgdntngctsag
ahfnpekqdhggpssavrhvgdlgnieaiedagvtkvsiqdsqislhgpnsiigrtlvvh
adpddlglggnelskttgnaggriacgviglaki
SCOPe Domain Coordinates for d3l9yb_:
Click to download the PDB-style file with coordinates for d3l9yb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3l9yb_:
- d3l9yb_ first appeared in SCOPe 2.01
- d3l9yb_ appears in SCOPe 2.07
View in 3D
