SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3l9ya_ (3l9y A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2031006Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2031007Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 protein domains)
  6. 2031020Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 2031500Species Silkworm (Bombyx mori) [TaxId:7091] [189285] (2 PDB entries)
  8. 2031501Domain d3l9ya_: 3l9y A: [180134]
    automated match to d1hl4a_
    complexed with cu, zn

Details for d3l9ya_

PDB Entry: 3l9y (more details), 1.8 Å

PDB Description: Crystal structures of holo and Cu-deficient Cu/ZnSOD from the silkworm Bombyx mori and the implications in Amyotrophic lateral sclerosis
PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d3l9ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l9ya_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Silkworm (Bombyx mori) [TaxId: 7091]}
pakavcvlrgdvsgtvffdqqdekspvvvsgevqgltkgkhgfhvhefgdntngctsaga
hfnpekqdhggpssavrhvgdlgnieaiedagvtkvsiqdsqislhgpnsiigrtlvvha
dpddlglggnelskttgnaggriacgviglaki

SCOPe Domain Coordinates for d3l9ya_:

Click to download the PDB-style file with coordinates for d3l9ya_.
(The format of our PDB-style files is described here.)

Timeline for d3l9ya_: