Lineage for d3l9ya_ (3l9y A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2763709Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2763729Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 2764360Species Silkworm (Bombyx mori) [TaxId:7091] [189285] (2 PDB entries)
  8. 2764365Domain d3l9ya_: 3l9y A: [180134]
    automated match to d1hl4a_
    complexed with cu, zn

Details for d3l9ya_

PDB Entry: 3l9y (more details), 1.8 Å

PDB Description: crystal structures of holo and cu-deficient cu/znsod from the silkworm bombyx mori and the implications in amyotrophic lateral sclerosis
PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d3l9ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l9ya_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Silkworm (Bombyx mori) [TaxId: 7091]}
pakavcvlrgdvsgtvffdqqdekspvvvsgevqgltkgkhgfhvhefgdntngctsaga
hfnpekqdhggpssavrhvgdlgnieaiedagvtkvsiqdsqislhgpnsiigrtlvvha
dpddlglggnelskttgnaggriacgviglaki

SCOPe Domain Coordinates for d3l9ya_:

Click to download the PDB-style file with coordinates for d3l9ya_.
(The format of our PDB-style files is described here.)

Timeline for d3l9ya_: