Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Thermococcus sibiricus [TaxId:604354] [189611] (2 PDB entries) |
Domain d3l77a_: 3l77 A: [180041] automated match to d2bd0a1 complexed with edo, gol, njp, pg4 |
PDB Entry: 3l77 (more details), 1.55 Å
SCOPe Domain Sequences for d3l77a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l77a_ c.2.1.0 (A:) automated matches {Thermococcus sibiricus [TaxId: 604354]} emkvavitgasrgigeaiaralardgyalalgarsvdrlekiahelmqeqgvevfyhhld vskaesveefskkvlerfgdvdvvvanaglgyfkrleelseeefhemievnllgvwrtlk afldslkrtgglalvttsdvsarlipygggyvstkwaaralvrtfqienpdvrffelrpg avdtyfggskpgkpkekgylkpdeiaeavrcllklpkdvrveelmlrsvyqrpey
Timeline for d3l77a_: