Lineage for d3l75c2 (3l75 C:262-380)

  1. Root: SCOPe 2.05
  2. 1955192Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1959225Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 1959226Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 1959227Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 1959228Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
  7. 1959236Species Chicken (Gallus gallus) [TaxId:9031] [81644] (8 PDB entries)
  8. 1959237Domain d3l75c2: 3l75 C:262-380 [199714]
    Other proteins in same PDB: d3l75a1, d3l75a2, d3l75b1, d3l75b2, d3l75c1, d3l75d1, d3l75d2, d3l75e1, d3l75e2, d3l75f_, d3l75g_, d3l75h_, d3l75j_, d3l75n1, d3l75n2, d3l75o1, d3l75o2, d3l75p1, d3l75q1, d3l75q2, d3l75r1, d3l75r2, d3l75s_, d3l75t_, d3l75u_, d3l75w_
    automated match to d1bccc2
    complexed with azi, bog, cdl, fes, fnm, hec, hem, pee, unl, uq

Details for d3l75c2

PDB Entry: 3l75 (more details), 2.79 Å

PDB Description: cytochrome bc1 complex from chicken with fenamidone bound
PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d3l75c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l75c2 f.32.1.1 (C:262-380) Mitochondrial cytochrome b subunit, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
plvtpphikpewyflfayailrsipnklggvlalaasvlilflipflhkskqrtmtfrpl
sqtlfwllvanlliltwigsqpvehpfiiigqmaslsyftillilfptigtlenkmlny

SCOPe Domain Coordinates for d3l75c2:

Click to download the PDB-style file with coordinates for d3l75c2.
(The format of our PDB-style files is described here.)

Timeline for d3l75c2: