![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
![]() | Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) ![]() Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
![]() | Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
![]() | Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species) also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [81639] (8 PDB entries) |
![]() | Domain d3l75c1: 3l75 C:1-261 [199713] Other proteins in same PDB: d3l75a1, d3l75a2, d3l75b1, d3l75b2, d3l75c2, d3l75d1, d3l75d2, d3l75e1, d3l75e2, d3l75f_, d3l75g_, d3l75h_, d3l75j_, d3l75n1, d3l75n2, d3l75o1, d3l75o2, d3l75p2, d3l75q1, d3l75q2, d3l75r1, d3l75r2, d3l75s_, d3l75t_, d3l75u_, d3l75w_ automated match to d1bccc3 complexed with azi, bog, cdl, fes, fnm, hec, hem, pee, unl, uq |
PDB Entry: 3l75 (more details), 2.79 Å
SCOPe Domain Sequences for d3l75c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l75c1 f.21.1.2 (C:1-261) Mitochondrial cytochrome b subunit, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} mapnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadt slafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvil lltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrff alhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpf ltlalfspnllgdpenftpan
Timeline for d3l75c1:
![]() Domains from other chains: (mouse over for more information) d3l75a1, d3l75a2, d3l75b1, d3l75b2, d3l75d1, d3l75d2, d3l75e1, d3l75e2, d3l75f_, d3l75g_, d3l75h_, d3l75j_, d3l75n1, d3l75n2, d3l75o1, d3l75o2, d3l75p1, d3l75p2, d3l75q1, d3l75q2, d3l75r1, d3l75r2, d3l75s_, d3l75t_, d3l75u_, d3l75w_ |