Lineage for d3l20b1 (3l20 B:4-147)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
beta-alpha-beta(3); 2 layers: alpha/betaSuperfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) 
Family d.32.1.0: automated matches [191344] (1 protein)
not a true familyProtein automated matches [190239] (26 species)
not a true protein
Species Staphylococcus aureus [TaxId:367830] [255916] (1 PDB entry) 
Domain d3l20b1: 3l20 B:4-147 [247328]
Other proteins in same PDB: d3l20a2, d3l20b2
automated match to d1u6la_
Details for d3l20b1
PDB Entry: 3l20 (more details), 2.45 Å
PDB Description: crystal structure of a hypothetical protein from staphylococcus aureus
PDB Compounds: (B:) Putative uncharacterized proteinSCOPe Domain Sequences for d3l20b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l20b1 d.32.1.0 (B:4-147) automated matches {Staphylococcus aureus [TaxId: 367830]}
mtalfpyiafenskealayyeevfgatdvkrlevgeeqashfgmtkeeaqeatmhaefev
lgvkvlcsdsfgradkinngisllidydvnnkedadkveafyeqikdhssieielpfadq
fwggkmgvftdkygvrwmlhgqdy
SCOPe Domain Coordinates for d3l20b1:
Click to download the PDB-style file with coordinates for d3l20b1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3l20b1:
- d3l20b1 first appeared in SCOPe 2.04, called d3l20b_
- d3l20b1 appears in SCOPe 2.07
View in 3D
