Lineage for d3l0la_ (3l0l A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1097039Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1097040Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1098043Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 1098044Protein automated matches [191142] (2 species)
    not a true protein
  7. 1098047Species Human (Homo sapiens) [TaxId:9606] [189274] (2 PDB entries)
  8. 1098048Domain d3l0la_: 3l0l A: [179842]
    automated match to d1n83a_
    protein/DNA complex; complexed with hc3

Details for d3l0la_

PDB Entry: 3l0l (more details), 1.74 Å

PDB Description: crystal structure of orphan nuclear receptor rorgamma in complex with natural ligand
PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d3l0la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l0la_ a.123.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerc
ahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffeg
kyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkve
qlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpp
lykelfs

SCOPe Domain Coordinates for d3l0la_:

Click to download the PDB-style file with coordinates for d3l0la_.
(The format of our PDB-style files is described here.)

Timeline for d3l0la_: