Lineage for d3kysa_ (3kys A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strandsSuperfamily b.1.18: E set domains [81296] (27 families) 
"Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
Family b.1.18.26: TEAD-like transcription factors, E-set domain [418817] (2 proteins)
Pfam PF17725
Protein Transcription factor TEAD1, YAP-binding domain [419133] (1 species) Species Human (Homo sapiens) [TaxId:9606] [419655] (4 PDB entries) 
Domain d3kysa_: 3kys A: [413287]
protein/DNA complex
Details for d3kysa_
PDB Entry: 3kys (more details), 2.8 Å
PDB Description: crystal structure of human yap and tead complex
PDB Compounds: (A:) Transcriptional enhancer factor TEF-1SCOPe Domain Sequences for d3kysa_:
Sequence, based on SEQRES records: (download)
>d3kysa_ b.1.18.26 (A:) Transcription factor TEAD1, YAP-binding domain {Human (Homo sapiens) [TaxId: 9606]}
sigttklrlvefsafleqqrdpdsynkhlfvhighanhsysdpllesvdirqiydkfpek
kgglkelfgkgpqnafflvkfwadlncniqddagafygvtsqyessenmtvtcstkvcsf
gkqvvekveteyarfengrfvyrinrspmceyminfihklkhlpekymmnsvlenftill
vvtnrdtqetllcmacvfevsnsehgaqhhiyrlvkd
Sequence, based on observed residues (ATOM records): (download)
>d3kysa_ b.1.18.26 (A:) Transcription factor TEAD1, YAP-binding domain {Human (Homo sapiens) [TaxId: 9606]}
sigttklrlvefsafleqqrdpdsynkhlfvhighlesvdirqiydkfpekkgglkelfg
kgpqnafflvkfwadlncniqddagafygvtsqyessenmtvtcstkvcsfgkqvvekve
teyarfengrfvyrinrspmceyminfihklkhlpekymmnsvlenftillvvtnrdtqe
tllcmacvfevsnsehgaqhhiyrlvkd
SCOPe Domain Coordinates for d3kysa_:
Click to download the PDB-style file with coordinates for d3kysa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3kysa_:
- d3kysa_ is new in SCOPe 2.08-stable
View in 3D
