Lineage for d3kdfc_ (3kdf C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1541191Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 1541383Protein automated matches [190206] (8 species)
    not a true protein
  7. 1541393Species Human (Homo sapiens) [TaxId:9606] [186959] (20 PDB entries)
  8. 1541410Domain d3kdfc_: 3kdf C: [179292]
    automated match to d1l1oa_
    protein/DNA complex; complexed with edo

Details for d3kdfc_

PDB Entry: 3kdf (more details), 1.98 Å

PDB Description: x-ray crystal structure of the human replication protein a complex from wheat germ cell free expression
PDB Compounds: (C:) Replication protein A 14 kDa subunit

SCOPe Domain Sequences for d3kdfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kdfc_ b.40.4.3 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svdmmdlprsrinagmlaqfidkpvcfvgrlekihptgkmfilsdgegkngtielmepld
eeisgivevvgrvtakatilctsyvqfkedshpfdlglyneavkiihdfpqfyplgiv

SCOPe Domain Coordinates for d3kdfc_:

Click to download the PDB-style file with coordinates for d3kdfc_.
(The format of our PDB-style files is described here.)

Timeline for d3kdfc_: