Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold |
Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) |
Family c.121.1.0: automated matches [191649] (1 protein) not a true family |
Protein automated matches [191196] (11 species) not a true protein |
Species Trypanosoma cruzi [TaxId:353153] [189510] (5 PDB entries) |
Domain d3k7pa_: 3k7p A: [179151] automated match to d1nn4b_ complexed with po4; mutant |
PDB Entry: 3k7p (more details), 1.4 Å
SCOPe Domain Sequences for d3k7pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k7pa_ c.121.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 353153]} mtrrvaigtdhpafaihenlilyvkeagdefvpvycgpktaesvdypdfasrvaemvark evefgvlaagsgigmsiaankvpgvraalchdhytaamsrihndanivcvgerttgvevi reiiitflqtpfsgeerhvrriekiraieasha
Timeline for d3k7pa_: