Lineage for d3k7pa_ (3k7p A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase foldSuperfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) 
Family c.121.1.0: automated matches [191649] (1 protein)
not a true familyProtein automated matches [191196] (11 species)
not a true protein
Species Trypanosoma cruzi [TaxId:353153] [189510] (5 PDB entries) 
Domain d3k7pa_: 3k7p A: [179151]
automated match to d1nn4b_
complexed with po4; mutant
Details for d3k7pa_
PDB Entry: 3k7p (more details), 1.4 Å
PDB Description: structure of mutant of ribose 5-phosphate isomerase type b from trypanosoma cruzi.
PDB Compounds: (A:) Ribose 5-phosphate isomeraseSCOPe Domain Sequences for d3k7pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k7pa_ c.121.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
mtrrvaigtdhpafaihenlilyvkeagdefvpvycgpktaesvdypdfasrvaemvark
evefgvlaagsgigmsiaankvpgvraalchdhytaamsrihndanivcvgerttgvevi
reiiitflqtpfsgeerhvrriekiraieasha
SCOPe Domain Coordinates for d3k7pa_:
Click to download the PDB-style file with coordinates for d3k7pa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3k7pa_:
- d3k7pa_ first appeared in SCOPe 2.01
- d3k7pa_ appears in SCOPe 2.07
View in 3D
