Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein automated matches [190202] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186949] (18 PDB entries) |
Domain d3k2mb_: 3k2m B: [196464] Other proteins in same PDB: d3k2mc_, d3k2md_ automated match to d3uyoa_ complexed with po4 |
PDB Entry: 3k2m (more details), 1.75 Å
SCOPe Domain Sequences for d3k2mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k2mb_ d.93.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintasdg klyvssesrfntlaelvhhhstvadglittlhypapk
Timeline for d3k2mb_: