Lineage for d3i98a_ (3i98 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1789893Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 1789894Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins)
    barrel, closed; n=5, S=8
  6. 1789983Protein automated matches [191079] (2 species)
    not a true protein
  7. 1789993Species Thermococcus thioreducens [TaxId:277988] [189009] (9 PDB entries)
  8. 1790015Domain d3i98a_: 3i98 A: [178158]
    automated match to d1twla_
    complexed with ace, ca, mpd, mrd

Details for d3i98a_

PDB Entry: 3i98 (more details), 1.85 Å

PDB Description: x-ray crystallographic structure of inorganic pyrophosphatase at 298k from archaeon thermococcus thioreducens
PDB Compounds: (A:) Th-IPP

SCOPe Domain Sequences for d3i98a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i98a_ b.40.5.1 (A:) automated matches {Thermococcus thioreducens [TaxId: 277988]}
mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip
qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk
disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfg

SCOPe Domain Coordinates for d3i98a_:

Click to download the PDB-style file with coordinates for d3i98a_.
(The format of our PDB-style files is described here.)

Timeline for d3i98a_: