Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) |
Family b.40.5.1: Inorganic pyrophosphatase [50325] (2 proteins) barrel, closed; n=5, S=8 |
Protein automated matches [191079] (2 species) not a true protein |
Species Thermococcus thioreducens [TaxId:277988] [189009] (9 PDB entries) |
Domain d3i98d_: 3i98 D: [178161] automated match to d1twla_ complexed with ace, ca, mpd, mrd |
PDB Entry: 3i98 (more details), 1.85 Å
SCOPe Domain Sequences for d3i98d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i98d_ b.40.5.1 (D:) automated matches {Thermococcus thioreducens [TaxId: 277988]} mnpfhelepgpevpevvyalieipkgsrnkyeldkktgllkldrvlyspffypvdygiip qtwyddgdpfdimvimrepvypltiiearpigimkmedsgdkdwkvlavpvedpyfndwk disdvpkafldeiahffqrykelqgkttkiegwgnaeeakreilraiemykekfg
Timeline for d3i98d_: