Lineage for d3hv2a_ (3hv2 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1837703Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1838070Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1838071Protein automated matches [190131] (59 species)
    not a true protein
  7. 1838248Species Pseudomonas fluorescens [TaxId:220664] [232518] (1 PDB entry)
  8. 1838249Domain d3hv2a_: 3hv2 A: [232519]
    automated match to d2rjna_
    complexed with so4

Details for d3hv2a_

PDB Entry: 3hv2 (more details), 1.5 Å

PDB Description: crystal structure of signal receiver domain of hd domain-containing protein from pseudomonas fluorescens pf-5
PDB Compounds: (A:) Response regulator/HD domain protein

SCOPe Domain Sequences for d3hv2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hv2a_ c.23.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
lnvatvtrrpeillvdsqevilqrlqqllsplpytlhfardatqalqllasrevdlvisa
ahlpqmdgptllarihqqypsttrilltgdpdlkliakainegeiyrylskpwddqelll
alrqalehqhsererl

SCOPe Domain Coordinates for d3hv2a_:

Click to download the PDB-style file with coordinates for d3hv2a_.
(The format of our PDB-style files is described here.)

Timeline for d3hv2a_: