SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3hv2a_ (3hv2 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2101601Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2101973Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2101974Protein automated matches [190131] (67 species)
    not a true protein
  7. 2102151Species Pseudomonas fluorescens [TaxId:220664] [232518] (1 PDB entry)
  8. 2102152Domain d3hv2a_: 3hv2 A: [232519]
    automated match to d2rjna_
    complexed with so4

Details for d3hv2a_

PDB Entry: 3hv2 (more details), 1.5 Å

PDB Description: Crystal structure of signal receiver domain OF HD domain-containing protein FROM Pseudomonas fluorescens Pf-5
PDB Compounds: (A:) Response regulator/HD domain protein

SCOPe Domain Sequences for d3hv2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hv2a_ c.23.1.0 (A:) automated matches {Pseudomonas fluorescens [TaxId: 220664]}
lnvatvtrrpeillvdsqevilqrlqqllsplpytlhfardatqalqllasrevdlvisa
ahlpqmdgptllarihqqypsttrilltgdpdlkliakainegeiyrylskpwddqelll
alrqalehqhsererl

SCOPe Domain Coordinates for d3hv2a_:

Click to download the PDB-style file with coordinates for d3hv2a_.
(The format of our PDB-style files is described here.)

Timeline for d3hv2a_: