Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (36 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187190] (2 PDB entries) |
Domain d3hrwa_: 3hrw A: [177796] automated match to d1a00a_ complexed with hem |
PDB Entry: 3hrw (more details), 2.8 Å
SCOPe Domain Sequences for d3hrwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hrwa_ a.1.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vlsgedksnikaawgkigghgaeygaealermfasfpttktyfphfdvshgsaqvkghgk kvadalasaaghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlashhpadftpa vhasldkflasvstvltskyr
Timeline for d3hrwa_: