Lineage for d3hrwa_ (3hrw A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1253759Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1255628Protein automated matches [190359] (36 species)
    not a true protein
  7. 1255844Species Mouse (Mus musculus) [TaxId:10090] [187190] (2 PDB entries)
  8. 1255846Domain d3hrwa_: 3hrw A: [177796]
    automated match to d1a00a_
    complexed with hem

Details for d3hrwa_

PDB Entry: 3hrw (more details), 2.8 Å

PDB Description: crystal structure of hemoglobin from mouse (mus musculus)at 2.8
PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d3hrwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hrwa_ a.1.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vlsgedksnikaawgkigghgaeygaealermfasfpttktyfphfdvshgsaqvkghgk
kvadalasaaghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlashhpadftpa
vhasldkflasvstvltskyr

SCOPe Domain Coordinates for d3hrwa_:

Click to download the PDB-style file with coordinates for d3hrwa_.
(The format of our PDB-style files is described here.)

Timeline for d3hrwa_: