Lineage for d3guga_ (3gug A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2437818Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2437819Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2438218Protein automated matches [190169] (7 species)
    not a true protein
  7. 2438223Species Human (Homo sapiens) [TaxId:9606] [188399] (47 PDB entries)
  8. 2438262Domain d3guga_: 3gug A: [177007]
    automated match to d1j96a_
    complexed with c2u, nap, zn; mutant

Details for d3guga_

PDB Entry: 3gug (more details), 1.9 Å

PDB Description: crystal structure of akr1c1 l308v mutant in complex with nadp and 3,5- dichlorosalicylic acid
PDB Compounds: (A:) Aldo-keto reductase family 1 member C1

SCOPe Domain Sequences for d3guga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3guga_ c.1.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcvklndghfmpvlgfgtyapaevpkskaleatklaieagfrhidsahlynneeqvglai
rskiadgsvkredifytsklwcnshrpelvrpalerslknlqldyvdlylihfpvsvkpg
eevipkdengkilfdtvdlcatweavekckdaglaksigvsnfnrrqlemilnkpglkyk
pvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpvlcala
kkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidglnrnvry
ltvdifagppnypfsdey

SCOPe Domain Coordinates for d3guga_:

Click to download the PDB-style file with coordinates for d3guga_.
(The format of our PDB-style files is described here.)

Timeline for d3guga_: