Lineage for d3ge3c_ (3ge3 C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1639834Superfamily d.15.12: TmoB-like [110814] (2 families) (S)
    possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies
  5. 1639856Family d.15.12.0: automated matches [191572] (1 protein)
    not a true family
  6. 1639857Protein automated matches [190991] (1 species)
    not a true protein
  7. 1639858Species Pseudomonas mendocina [TaxId:300] [188696] (15 PDB entries)
  8. 1639859Domain d3ge3c_: 3ge3 C: [176553]
    Other proteins in same PDB: d3ge3a_, d3ge3e_
    automated match to d1t0rc_
    complexed with act, cl, fe; mutant

Details for d3ge3c_

PDB Entry: 3ge3 (more details), 1.52 Å

PDB Description: crystal structure of the reduced toluene 4-monooxygenase hd t201a mutant complex
PDB Compounds: (C:) Toluene-4-monooxygenase system protein B

SCOPe Domain Sequences for d3ge3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ge3c_ d.15.12.0 (C:) automated matches {Pseudomonas mendocina [TaxId: 300]}
safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf
prdmtiaesglnptevidvvfee

SCOPe Domain Coordinates for d3ge3c_:

Click to download the PDB-style file with coordinates for d3ge3c_.
(The format of our PDB-style files is described here.)

Timeline for d3ge3c_: