![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.12: TmoB-like [110814] (2 families) ![]() possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies |
![]() | Family d.15.12.0: automated matches [191572] (1 protein) not a true family |
![]() | Protein automated matches [190991] (1 species) not a true protein |
![]() | Species Pseudomonas mendocina [TaxId:300] [188696] (15 PDB entries) |
![]() | Domain d3ge3c_: 3ge3 C: [176553] Other proteins in same PDB: d3ge3a_, d3ge3e_ automated match to d1t0rc_ complexed with act, cl, fe; mutant |
PDB Entry: 3ge3 (more details), 1.52 Å
SCOPe Domain Sequences for d3ge3c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ge3c_ d.15.12.0 (C:) automated matches {Pseudomonas mendocina [TaxId: 300]} safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf prdmtiaesglnptevidvvfee
Timeline for d3ge3c_: