Lineage for d3g1da_ (3g1d A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) 
Family c.1.2.3: Decarboxylase [51375] (4 proteins) Protein automated matches [190130] (11 species)
not a true proteinSpecies Methanothermobacter thermautotrophicus [TaxId:187420] [188934] (67 PDB entries) 
Domain d3g1da_: 3g1d A: [176250]
automated match to d1dv7a_
complexed with u
Details for d3g1da_
PDB Entry: 3g1d (more details), 1.5 Å
PDB Description: crystal structure of orotidine 5'-monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with uridine 5'- monophosphate
PDB Compounds: (A:) orotidine 5'-phosphate decarboxylaseSCOPe Domain Sequences for d3g1da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g1da_ c.1.2.3 (A:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
vmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcri
iadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltems
hpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqgg
dpgetlrfadaiivgrsiyladnpaaaaagiiesikdl
SCOPe Domain Coordinates for d3g1da_:
Click to download the PDB-style file with coordinates for d3g1da_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3g1da_:
- d3g1da_ first appeared in SCOPe 2.01
- d3g1da_ appears in SCOPe 2.07
View in 3D
