Lineage for d3favc_ (3fav C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2318581Superfamily a.25.3: EsxAB dimer-like [140453] (2 families) (S)
    (hetero)dimer of alpha-hairpin subunits similar to that of the half-ferritin family; no bound metals
  5. 2318582Family a.25.3.1: ESAT-6 like [140454] (3 proteins)
    Pfam PF06013; the conserwed WxG motif makes the turn at the alpha-hairpin tip
  6. 2318591Protein automated matches [191103] (1 species)
    not a true protein
  7. 2318592Species Mycobacterium tuberculosis [TaxId:83332] [189126] (1 PDB entry)
  8. 2318594Domain d3favc_: 3fav C: [175628]
    Other proteins in same PDB: d3favb_, d3favd_
    automated match to d1wa8a1
    complexed with imd, zn

Details for d3favc_

PDB Entry: 3fav (more details), 2.15 Å

PDB Description: Structure of the CFP10-ESAT6 complex from Mycobacterium tuberculosis
PDB Compounds: (C:) ESAT-6-like protein esxB

SCOPe Domain Sequences for d3favc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3favc_ a.25.3.1 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
maemktdaatlaqeagnferisgdlktqidqvestagslqgqwrgaagtaaqaavvrfqe
aankqkqeldeistnirqagvqysradeeq

SCOPe Domain Coordinates for d3favc_:

Click to download the PDB-style file with coordinates for d3favc_.
(The format of our PDB-style files is described here.)

Timeline for d3favc_: