Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins) |
Protein automated matches [190696] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188122] (16 PDB entries) |
Domain d3ezza_: 3ezz A: [175362] automated match to d1m3ga_ complexed with so4 |
PDB Entry: 3ezz (more details), 2.9 Å
SCOPe Domain Sequences for d3ezza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ezza_ c.45.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mggpveilpflylgsayhaarrdmldalgitallnvssdcpnhfeghyqykcipvednhk adisswfmeaieyidavkdcrgrvlvhsqagisrsaticlaylmmkkrvrleeafefvkq rrsiispnfsfmgqllqfesqvla
Timeline for d3ezza_: