Lineage for d3ey1a_ (3ey1 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1606596Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1606597Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 1606598Protein BH0863-like Ribonuclease H [142490] (3 species)
    new class of RNase H
  7. 1606599Species Bacillus halodurans [TaxId:86665] [142491] (19 PDB entries)
    Uniprot Q9KEI9 61-193! Uniprot Q9KEI9 62-193
    BH0863
  8. 1606613Domain d3ey1a_: 3ey1 A: [175303]
    automated match to d1zbfa1
    protein/DNA complex; complexed with gol

Details for d3ey1a_

PDB Entry: 3ey1 (more details), 1.6 Å

PDB Description: a conformational transition in the structure of a 2'-thiomethyl- modified dna visualized at high resolution
PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d3ey1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ey1a_ c.55.3.1 (A:) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]}
akeeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglr
ylkernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpi
lkwqtdkwgeikadygr

SCOPe Domain Coordinates for d3ey1a_:

Click to download the PDB-style file with coordinates for d3ey1a_.
(The format of our PDB-style files is described here.)

Timeline for d3ey1a_: